PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_12466.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 282aa    MW: 31594.4 Da    PI: 6.365
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_12466.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.41e-51101371128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                   lppGfrF P+d+elv++yL kkv++++ +   ++ evd++  ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev s  +
  MLOC_12466.1  10 LPPGFRFYPSDQELVCHYLYKKVTNERASQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVRSPsT 105
                   79*************************888.78***************77777889*************************************9967 PP

           NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                   +++vg++ktLvfy+grap+g+kt+Wvmhe+rl
  MLOC_12466.1 106 RAVVGMRKTLVFYQGRAPNGTKTSWVMHEFRL 137
                   778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-608156IPR003441NAC domain
PROSITE profilePS5100558.46810156IPR003441NAC domain
PfamPF023654.0E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGLREIESTL PPGFRFYPSD QELVCHYLYK KVTNERASQG TLVEVDLHAR EPWELPDVAK  60
LTASEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RSPSTRAVVG MRKTLVFYQG  120
RAPNGTKTSW VMHEFRLDSP HLPPREDWVL CRVFQKQKVD GDQDNARSSS PTFAGSSQPA  180
PELPVMDAGN DHMTGFAPPR QEEIMACGSN PLMNAAVWQQ YNSLLLDQYP QEETTAGGSP  240
ALARGVTGDD CGFFFDSGFE DMAGLGQLGA MPMRFPQGQG WS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5011574166NO APICAL MERISTEM PROTEIN
1ut4_B2e-5011574166NO APICAL MERISTEM PROTEIN
1ut7_A2e-5011574166NO APICAL MERISTEM PROTEIN
1ut7_B2e-5011574166NO APICAL MERISTEM PROTEIN
4dul_A2e-5011574166NAC domain-containing protein 19
4dul_B2e-5011574166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2484800.0AK248480.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf7e16, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580130.11e-150PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FRV41e-62NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLM0UN530.0M0UN53_HORVD; Uncharacterized protein
STRINGMLOC_12466.20.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.18e-82NAC domain containing protein 74